PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00002653.1.g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family NF-YB
Protein Properties Length: 93aa    MW: 10821.1 Da    PI: 7.0269
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00002653.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB49.88.4e-161445497
                           NF-YB 54 cqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97
                                    c++e+rkt+ngdd++ al+tlGf+dy++ l+ yl++ r+ eg++
  FANhyb_rscf00002653.1.g00001.1  1 CRKERRKTVNGDDICCALGTLGFDDYAALLRRYLHRCRDQEGAE 44
                                    99*************************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.104.3E-14157IPR009072Histone-fold
PRINTSPR006153.8E-5114No hitNo description
SuperFamilySSF471131.2E-10152IPR009072Histone-fold
PRINTSPR006153.8E-52038No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 93 aa     Download sequence    Send to blast
CRKERRKTVN GDDICCALGT LGFDDYAALL RRYLHRCRDQ EGAEHRANIG KNNNEDELKL  60
LANNNILSTA QEQRIIMIMN QYDHPDHHDI QKT
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004296821.12e-59PREDICTED: nuclear transcription factor Y subunit B-4-like
SwissprotO822481e-16NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBLA0A059D1L51e-19A0A059D1L5_EUCGR; Uncharacterized protein
TrEMBLA0A067K7773e-19A0A067K777_JATCU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80532131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.18e-18nuclear factor Y, subunit B5